TAF1C,MGC:39976,SL1
  • TAF1C,MGC:39976,SL1

Anti-TAF1C Antibody 25ul

Ref: AN-HPA072229-25ul
Anti-TAF1C

Información del producto

Polyclonal Antibody against Human TAF1C, Gene description: TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa, Alternative Gene Names: MGC:39976, SL1, TAFI110, TAFI95, Validated applications: ICC, Uniprot ID: Q15572, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAF1C
Gene Description TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE
Immunogen FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC:39976, SL1, TAFI110, TAFI95
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15572
HTS Code 3002150000
Gene ID 9013
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TAF1C Antibody 25ul

Anti-TAF1C Antibody 25ul