CYTH4,CYT4
  • CYTH4,CYT4

Anti-CYTH4 Antibody 25ul

Ref: AN-HPA071573-25ul
Anti-CYTH4

Información del producto

Polyclonal Antibody against Human CYTH4, Gene description: cytohesin 4, Alternative Gene Names: CYT4, cytohesin-4, PSCD4, Validated applications: IHC, Uniprot ID: Q9UIA0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYTH4
Gene Description cytohesin 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
Immunogen MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CYT4, cytohesin-4, PSCD4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UIA0
HTS Code 3002150000
Gene ID 27128
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYTH4 Antibody 25ul

Anti-CYTH4 Antibody 25ul