TNFRSF9,4-1BB,CD137
  • TNFRSF9,4-1BB,CD137

Anti-TNFRSF9 Antibody 100ul

Ref: AN-HPA071425-100ul
Anti-TNFRSF9

Información del producto

Polyclonal Antibody against Human TNFRSF9, Gene description: tumor necrosis factor receptor superfamily, member 9, Alternative Gene Names: 4-1BB, CD137, ILA, Validated applications: ICC, Uniprot ID: Q07011, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNFRSF9
Gene Description tumor necrosis factor receptor superfamily, member 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Immunogen KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4-1BB, CD137, ILA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07011
HTS Code 3002150000
Gene ID 3604
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNFRSF9 Antibody 100ul

Anti-TNFRSF9 Antibody 100ul