TCF7L1,TCF3
  • TCF7L1,TCF3

Anti-TCF7L1 Antibody 25ul

Ref: AN-HPA071298-25ul
Anti-TCF7L1

Información del producto

Polyclonal Antibody against Human TCF7L1, Gene description: transcription factor 7-like 1 (T-cell specific, HMG-box), Alternative Gene Names: TCF3, Validated applications: ICC, Uniprot ID: Q9HCS4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCF7L1
Gene Description transcription factor 7-like 1 (T-cell specific, HMG-box)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
Immunogen ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TCF3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCS4
HTS Code 3002150000
Gene ID 83439
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TCF7L1 Antibody 25ul

Anti-TCF7L1 Antibody 25ul