LZTR1,BTBD29,LZTR-1
  • LZTR1,BTBD29,LZTR-1

Anti-LZTR1 Antibody 25ul

Ref: AN-HPA071248-25ul
Anti-LZTR1

Información del producto

Polyclonal Antibody against Human LZTR1, Gene description: leucine-zipper-like transcription regulator 1, Alternative Gene Names: BTBD29, LZTR-1, Validated applications: IHC, Uniprot ID: Q8N653, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LZTR1
Gene Description leucine-zipper-like transcription regulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP
Immunogen HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BTBD29, LZTR-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N653
HTS Code 3002150000
Gene ID 8216
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LZTR1 Antibody 25ul

Anti-LZTR1 Antibody 25ul