WASHC5,KIAA0196,SPG8
  • WASHC5,KIAA0196,SPG8

Anti-WASHC5 Antibody 25ul

Ref: AN-HPA070916-25ul
Anti-WASHC5

Información del producto

Polyclonal Antibody against Human WASHC5, Gene description: WASH complex subunit 5, Alternative Gene Names: KIAA0196, SPG8, Validated applications: ICC, Uniprot ID: Q12768, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WASHC5
Gene Description WASH complex subunit 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVD
Immunogen HRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0196, SPG8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12768
HTS Code 3002150000
Gene ID 9897
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WASHC5 Antibody 25ul

Anti-WASHC5 Antibody 25ul