EFEMP1,DHRD,FBLN3
  • EFEMP1,DHRD,FBLN3

Anti-EFEMP1 Antibody 100ul

Ref: AN-HPA070841-100ul
Anti-EFEMP1

Información del producto

Polyclonal Antibody against Human EFEMP1, Gene description: EGF containing fibulin-like extracellular matrix protein 1, Alternative Gene Names: DHRD, FBLN3, FBNL, MTLV, S1-5, Validated applications: IHC, Uniprot ID: Q12805, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EFEMP1
Gene Description EGF containing fibulin-like extracellular matrix protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
Immunogen RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DHRD, FBLN3, FBNL, MTLV, S1-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12805
HTS Code 3002150000
Gene ID 2202
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EFEMP1 Antibody 100ul

Anti-EFEMP1 Antibody 100ul