PEA15,HMAT1
  • PEA15,HMAT1

Anti-PEA15 Antibody 25ul

Ref: AN-HPA070820-25ul
Anti-PEA15

Información del producto

Polyclonal Antibody against Human PEA15, Gene description: phosphoprotein enriched in astrocytes 15, Alternative Gene Names: HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED, Validated applications: IHC, Uniprot ID: Q15121, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PEA15
Gene Description phosphoprotein enriched in astrocytes 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD
Immunogen PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15121
HTS Code 3002150000
Gene ID 8682
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PEA15 Antibody 25ul

Anti-PEA15 Antibody 25ul