MMP19,MMP18,RASI-1
  • MMP19,MMP18,RASI-1

Anti-MMP19 Antibody 25ul

Ref: AN-HPA070804-25ul
Anti-MMP19

Información del producto

Polyclonal Antibody against Human MMP19, Gene description: matrix metallopeptidase 19, Alternative Gene Names: MMP18, RASI-1, Validated applications: ICC, WB, Uniprot ID: Q99542, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MMP19
Gene Description matrix metallopeptidase 19
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL
Immunogen PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MMP18, RASI-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99542
HTS Code 3002150000
Gene ID 4327
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MMP19 Antibody 25ul

Anti-MMP19 Antibody 25ul