TRIP11,CEV14
  • TRIP11,CEV14

Anti-TRIP11 Antibody 25ul

Ref: AN-HPA070684-25ul
Anti-TRIP11

Información del producto

Polyclonal Antibody against Human TRIP11, Gene description: thyroid hormone receptor interactor 11, Alternative Gene Names: CEV14, GMAP-210, GMAP210, Trip230, Validated applications: ICC, Uniprot ID: Q15643, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRIP11
Gene Description thyroid hormone receptor interactor 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
Immunogen MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CEV14, GMAP-210, GMAP210, Trip230
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15643
HTS Code 3002150000
Gene ID 9321
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRIP11 Antibody 25ul

Anti-TRIP11 Antibody 25ul