BTAF1,MOT1
  • BTAF1,MOT1

Anti-BTAF1 Antibody 100ul

Ref: AN-HPA070682-100ul
Anti-BTAF1

Información del producto

Polyclonal Antibody against Human BTAF1, Gene description: BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa, Alternative Gene Names: MOT1, TAF(II)170, TAF-172, TAF172, TAFII170, Validated applications: ICC, Uniprot ID: O14981, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BTAF1
Gene Description BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
Immunogen QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MOT1, TAF(II)170, TAF-172, TAF172, TAFII170
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14981
HTS Code 3002150000
Gene ID 9044
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BTAF1 Antibody 100ul

Anti-BTAF1 Antibody 100ul