INO80B,hIes2
  • INO80B,hIes2

Anti-INO80B Antibody 100ul

Ref: AN-HPA070644-100ul
Anti-INO80B

Información del producto

Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name INO80B
Gene Description INO80 complex subunit B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
Immunogen GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C086
HTS Code 3002150000
Gene ID 83444
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-INO80B Antibody 100ul

Anti-INO80B Antibody 100ul