ABI2,ABI-2,ABI2B
  • ABI2,ABI-2,ABI2B

Anti-ABI2 Antibody 100ul

Ref: AN-HPA070567-100ul
Anti-ABI2

Información del producto

Polyclonal Antibody against Human ABI2, Gene description: abl-interactor 2, Alternative Gene Names: ABI-2, ABI2B, AblBP3, AIP-1, argBPIA, SSH3BP2, Validated applications: IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABI2
Gene Description abl-interactor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
Immunogen PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABI-2, ABI2B, AblBP3, AIP-1, argBPIA, SSH3BP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 10152
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABI2 Antibody 100ul

Anti-ABI2 Antibody 100ul