NCOA1,bHLHe74
  • NCOA1,bHLHe74

Anti-NCOA1 Antibody 25ul

Ref: AN-HPA070520-25ul
Anti-NCOA1

Información del producto

Polyclonal Antibody against Human NCOA1, Gene description: nuclear receptor coactivator 1, Alternative Gene Names: bHLHe74, F-SRC-1, KAT13A, NCoA-1, RIP160, SRC1, Validated applications: ICC, Uniprot ID: Q15788, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NCOA1
Gene Description nuclear receptor coactivator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL
Immunogen PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHe74, F-SRC-1, KAT13A, NCoA-1, RIP160, SRC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15788
HTS Code 3002150000
Gene ID 8648
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NCOA1 Antibody 25ul

Anti-NCOA1 Antibody 25ul