JAK3,JAK-3
  • JAK3,JAK-3

Anti-JAK3 Antibody 25ul

Ref: AN-HPA070314-25ul
Anti-JAK3

Información del producto

Polyclonal Antibody against Human JAK3, Gene description: Janus kinase 3, Alternative Gene Names: JAK-3, JAK3_HUMAN, JAKL, L-JAK, LJAK, Validated applications: IHC, Uniprot ID: P52333, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name JAK3
Gene Description Janus kinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGL
Immunogen ETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names JAK-3, JAK3_HUMAN, JAKL, L-JAK, LJAK
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52333
HTS Code 3002150000
Gene ID 3718
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-JAK3 Antibody 25ul

Anti-JAK3 Antibody 25ul