PHF7,HSPC226,NYD-SP6
  • PHF7,HSPC226,NYD-SP6

Anti-PHF7 Antibody 100ul

Ref: AN-HPA070305-100ul
Anti-PHF7

Información del producto

Polyclonal Antibody against Human PHF7, Gene description: PHD finger protein 7, Alternative Gene Names: HSPC226, NYD-SP6, Validated applications: ICC, Uniprot ID: Q9BWX1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PHF7
Gene Description PHD finger protein 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEE
Immunogen IHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC226, NYD-SP6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BWX1
HTS Code 3002150000
Gene ID 51533
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PHF7 Antibody 100ul

Anti-PHF7 Antibody 100ul