VARS2,DKFZP434L1435
  • VARS2,DKFZP434L1435

Anti-VARS2 Antibody 25ul

Ref: AN-HPA070267-25ul
Anti-VARS2

Información del producto

Polyclonal Antibody against Human VARS2, Gene description: valyl-tRNA synthetase 2, mitochondrial, Alternative Gene Names: DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL, Validated applications: IHC, WB, Uniprot ID: Q5ST30, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VARS2
Gene Description valyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
Immunogen NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5ST30
HTS Code 3002150000
Gene ID 57176
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VARS2 Antibody 25ul

Anti-VARS2 Antibody 25ul