NR4A1,GFRP1,HMR,N10
  • NR4A1,GFRP1,HMR,N10

Anti-NR4A1 Antibody 25ul

Ref: AN-HPA070142-25ul
Anti-NR4A1

Información del producto

Polyclonal Antibody against Human NR4A1, Gene description: nuclear receptor subfamily 4 group A member 1, Alternative Gene Names: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3, Validated applications: IHC, Uniprot ID: P22736, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NR4A1
Gene Description nuclear receptor subfamily 4 group A member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
Immunogen PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22736
HTS Code 3002150000
Gene ID 3164
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NR4A1 Antibody 25ul

Anti-NR4A1 Antibody 25ul