DMWD,D19S593E
  • DMWD,D19S593E

Anti-DMWD Antibody 25ul

Ref: AN-HPA069843-25ul
Anti-DMWD

Información del producto

Polyclonal Antibody against Human DMWD, Gene description: dystrophia myotonica, WD repeat containing, Alternative Gene Names: D19S593E, DMR-N9, gene59, Validated applications: IHC, Uniprot ID: Q09019, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DMWD
Gene Description dystrophia myotonica, WD repeat containing
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYA
Immunogen TYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D19S593E, DMR-N9, gene59
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q09019
HTS Code 3002150000
Gene ID 1762
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DMWD Antibody 25ul

Anti-DMWD Antibody 25ul