KRT13,CK13,K13
  • KRT13,CK13,K13

Anti-KRT13 Antibody 25ul

Ref: AN-HPA069771-25ul
Anti-KRT13

Información del producto

Polyclonal Antibody against Human KRT13, Gene description: keratin 13, Alternative Gene Names: CK13, K13, MGC161462, MGC3781, Validated applications: ICC, WB, Uniprot ID: P13646, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KRT13
Gene Description keratin 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Immunogen EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CK13, K13, MGC161462, MGC3781
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13646
HTS Code 3002150000
Gene ID 3860
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KRT13 Antibody 25ul

Anti-KRT13 Antibody 25ul