NFAT5,KIAA0827
  • NFAT5,KIAA0827

Anti-NFAT5 Antibody 25ul

Ref: AN-HPA069711-25ul
Anti-NFAT5

Información del producto

Polyclonal Antibody against Human NFAT5, Gene description: nuclear factor of activated T-cells 5, tonicity-responsive, Alternative Gene Names: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP, Validated applications: ICC, IHC, Uniprot ID: O94916, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NFAT5
Gene Description nuclear factor of activated T-cells 5, tonicity-responsive
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
Immunogen SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94916
HTS Code 3002150000
Gene ID 10725
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NFAT5 Antibody 25ul

Anti-NFAT5 Antibody 25ul