RP11-195F19.5
  • RP11-195F19.5

Anti-RP11-195F19.5 Antibody 100ul

Ref: AN-HPA069617-100ul
Anti-RP11-195F19.5

Información del producto

Polyclonal Antibody against Human RP11-195F19.5, Gene description: Uncharacterized protein {ECO:0000313|Ensembl:ENSP00000455581} , Validated applications: ICC, IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RP11-195F19.5
Gene Description Uncharacterized protein {ECO:0000313|Ensembl:ENSP00000455581}
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PLQETFGAQDMSGMRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPGEQKLEPLRGLMSCLSSGLGPTPQRSGRGFPRRSPTAAAQPASALK
Immunogen PLQETFGAQDMSGMRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPGEQKLEPLRGLMSCLSSGLGPTPQRSGRGFPRRSPTAAAQPASALK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 730098
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RP11-195F19.5 Antibody 100ul

Anti-RP11-195F19.5 Antibody 100ul