WLS,C1orf139,EVI
  • WLS,C1orf139,EVI

Anti-WLS Antibody 100ul

Ref: AN-HPA069520-100ul
Anti-WLS

Información del producto

Polyclonal Antibody against Human WLS, Gene description: wntless Wnt ligand secretion mediator, Alternative Gene Names: C1orf139, EVI, FLJ23091, GPR177, mig-14, MRP, wls, Validated applications: IHC, WB, Uniprot ID: Q5T9L3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WLS
Gene Description wntless Wnt ligand secretion mediator
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Immunogen LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf139, EVI, FLJ23091, GPR177, mig-14, MRP, wls
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T9L3
HTS Code 3002150000
Gene ID 79971
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WLS Antibody 100ul

Anti-WLS Antibody 100ul