FAM133B,MGC40405
  • FAM133B,MGC40405

Anti-FAM133B Antibody 100ul

Ref: AN-HPA069513-100ul
Anti-FAM133B

Información del producto

Polyclonal Antibody against Human FAM133B, Gene description: family with sequence similarity 133, member B, Alternative Gene Names: MGC40405, Validated applications: ICC, Uniprot ID: Q5BKY9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM133B
Gene Description family with sequence similarity 133, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AMARSRGPIQSSGPTIQDYLNRPRPTWEEV
Immunogen AMARSRGPIQSSGPTIQDYLNRPRPTWEEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC40405
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5BKY9
HTS Code 3002150000
Gene ID 257415
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM133B Antibody 100ul

Anti-FAM133B Antibody 100ul