HTR3A,5-HT3A,5-HT3R
  • HTR3A,5-HT3A,5-HT3R

Anti-HTR3A Antibody 100ul

Ref: AN-HPA069442-100ul
Anti-HTR3A

Información del producto

Polyclonal Antibody against Human HTR3A, Gene description: 5-hydroxytryptamine receptor 3A, Alternative Gene Names: 5-HT3A, 5-HT3R, HTR3, Validated applications: IHC, Uniprot ID: P46098, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HTR3A
Gene Description 5-hydroxytryptamine receptor 3A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI
Immunogen LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 5-HT3A, 5-HT3R, HTR3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46098
HTS Code 3002150000
Gene ID 3359
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HTR3A Antibody 100ul

Anti-HTR3A Antibody 100ul