IFFO1,HOM-TES-103
  • IFFO1,HOM-TES-103

Anti-IFFO1 Antibody 100ul

Ref: AN-HPA069344-100ul
Anti-IFFO1

Información del producto

Polyclonal Antibody against Human IFFO1, Gene description: intermediate filament family orphan 1, Alternative Gene Names: HOM-TES-103, IFFO, Validated applications: IHC, Uniprot ID: Q0D2I5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFFO1
Gene Description intermediate filament family orphan 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
Immunogen LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOM-TES-103, IFFO
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q0D2I5
HTS Code 3002150000
Gene ID 25900
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFFO1 Antibody 100ul

Anti-IFFO1 Antibody 100ul