RFC1,A1,MHCBFB
  • RFC1,A1,MHCBFB

Anti-RFC1 Antibody 100ul

Ref: AN-HPA069306-100ul
Anti-RFC1

Información del producto

Polyclonal Antibody against Human RFC1, Gene description: replication factor C (activator 1) 1, 145kDa, Alternative Gene Names: A1, MHCBFB, PO-GA, RFC140, Validated applications: ICC, Uniprot ID: P35251, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RFC1
Gene Description replication factor C (activator 1) 1, 145kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Immunogen LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A1, MHCBFB, PO-GA, RFC140
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35251
HTS Code 3002150000
Gene ID 5981
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RFC1 Antibody 100ul

Anti-RFC1 Antibody 100ul