DCLRE1C,A-SCID
  • DCLRE1C,A-SCID

Anti-DCLRE1C Antibody 100ul

Ref: AN-HPA069295-100ul
Anti-DCLRE1C

Información del producto

Polyclonal Antibody against Human DCLRE1C, Gene description: DNA cross-link repair 1C, Alternative Gene Names: A-SCID, ARTEMIS, FLJ11360, SCIDA, SNM1C, Validated applications: ICC, Uniprot ID: Q96SD1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCLRE1C
Gene Description DNA cross-link repair 1C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Immunogen WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A-SCID, ARTEMIS, FLJ11360, SCIDA, SNM1C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96SD1
HTS Code 3002150000
Gene ID 64421
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DCLRE1C Antibody 100ul

Anti-DCLRE1C Antibody 100ul