IFRD2,IFNRP,SKMc15
  • IFRD2,IFNRP,SKMc15

Anti-IFRD2 Antibody 100ul

Ref: AN-HPA068560-100ul
Anti-IFRD2

Información del producto

Polyclonal Antibody against Human IFRD2, Gene description: interferon-related developmental regulator 2, Alternative Gene Names: IFNRP, SKMc15, SM15, Validated applications: ICC, IHC, WB, Uniprot ID: Q12894, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFRD2
Gene Description interferon-related developmental regulator 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE
Immunogen CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IFNRP, SKMc15, SM15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12894
HTS Code 3002150000
Gene ID 7866
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFRD2 Antibody 100ul

Anti-IFRD2 Antibody 100ul