CYFIP1,KIAA0068
  • CYFIP1,KIAA0068

Anti-CYFIP1 Antibody 25ul

Ref: AN-HPA068106-25ul
Anti-CYFIP1

Información del producto

Polyclonal Antibody against Human CYFIP1, Gene description: cytoplasmic FMR1 interacting protein 1, Alternative Gene Names: KIAA0068, P140SRA-1, SHYC, Validated applications: IHC, Uniprot ID: Q7L576, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYFIP1
Gene Description cytoplasmic FMR1 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN
Immunogen TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0068, P140SRA-1, SHYC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L576
HTS Code 3002150000
Gene ID 23191
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYFIP1 Antibody 25ul

Anti-CYFIP1 Antibody 25ul