MROH6,C8orf73
  • MROH6,C8orf73

Anti-MROH6 Antibody 25ul

Ref: AN-HPA068049-25ul
Anti-MROH6

Información del producto

Polyclonal Antibody against Human MROH6, Gene description: maestro heat-like repeat family member 6, Alternative Gene Names: C8orf73, Validated applications: ICC, IHC, Uniprot ID: A6NGR9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MROH6
Gene Description maestro heat-like repeat family member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE
Immunogen LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C8orf73
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NGR9
HTS Code 3002150000
Gene ID 642475
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MROH6 Antibody 25ul

Anti-MROH6 Antibody 25ul