RD3L,TDRD9-AS1
  • RD3L,TDRD9-AS1

Anti-RD3L Antibody 100ul

Ref: AN-HPA067971-100ul
Anti-RD3L

Información del producto

Polyclonal Antibody against Human RD3L, Gene description: retinal degeneration 3-like, Alternative Gene Names: TDRD9-AS1, TDRD9AS1, Validated applications: IHC, Uniprot ID: P0DJH9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RD3L
Gene Description retinal degeneration 3-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL
Immunogen VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TDRD9-AS1, TDRD9AS1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0DJH9
HTS Code 3002150000
Gene ID 647286
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RD3L Antibody 100ul

Anti-RD3L Antibody 100ul