TAF5L,PAF65B
  • TAF5L,PAF65B

Anti-TAF5L Antibody 25ul

Ref: AN-HPA067941-25ul
Anti-TAF5L

Información del producto

Polyclonal Antibody against Human TAF5L, Gene description: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa, Alternative Gene Names: PAF65B, Validated applications: ICC, WB, Uniprot ID: O75529, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAF5L
Gene Description TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP
Immunogen NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PAF65B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75529
HTS Code 3002150000
Gene ID 27097
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TAF5L Antibody 25ul

Anti-TAF5L Antibody 25ul