NCAPH2,384D8-2
  • NCAPH2,384D8-2

Anti-NCAPH2 Antibody 25ul

Ref: AN-HPA067932-25ul
Anti-NCAPH2

Información del producto

Polyclonal Antibody against Human NCAPH2, Gene description: non-SMC condensin II complex, subunit H2, Alternative Gene Names: 384D8-2, CAP-H2, hCAP-H2, Validated applications: ICC, WB, Uniprot ID: Q6IBW4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NCAPH2
Gene Description non-SMC condensin II complex, subunit H2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG
Immunogen AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 384D8-2, CAP-H2, hCAP-H2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IBW4
HTS Code 3002150000
Gene ID 29781
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NCAPH2 Antibody 25ul

Anti-NCAPH2 Antibody 25ul