P2RX5,LRH-1,P2X5
  • P2RX5,LRH-1,P2X5

Anti-P2RX5 Antibody 25ul

Ref: AN-HPA067827-25ul
Anti-P2RX5

Información del producto

Polyclonal Antibody against Human P2RX5, Gene description: purinergic receptor P2X, ligand gated ion channel, 5, Alternative Gene Names: LRH-1, P2X5, Validated applications: ICC, IHC, Uniprot ID: Q93086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name P2RX5
Gene Description purinergic receptor P2X, ligand gated ion channel, 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE
Immunogen TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LRH-1, P2X5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q93086
HTS Code 3002150000
Gene ID 5026
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-P2RX5 Antibody 25ul

Anti-P2RX5 Antibody 25ul