SP140,LYSP100-A
  • SP140,LYSP100-A

Anti-SP140 Antibody 100ul

Ref: AN-HPA067493-100ul
Anti-SP140

Información del producto

Polyclonal Antibody against Human SP140, Gene description: SP140 nuclear body protein, Alternative Gene Names: LYSP100-A, LYSP100-B, Validated applications: ICC, IHC, Uniprot ID: Q13342, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SP140
Gene Description SP140 nuclear body protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA
Immunogen LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LYSP100-A, LYSP100-B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13342
HTS Code 3002150000
Gene ID 11262
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SP140 Antibody 100ul

Anti-SP140 Antibody 100ul