IFT52,C20orf9
  • IFT52,C20orf9

Anti-IFT52 Antibody 25ul

Ref: AN-HPA067423-25ul
Anti-IFT52

Información del producto

Polyclonal Antibody against Human IFT52, Gene description: intraflagellar transport 52, Alternative Gene Names: C20orf9, CGI-53, dJ1028D15.1, NGD2, NGD5, Validated applications: IHC, Uniprot ID: Q9Y366, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IFT52
Gene Description intraflagellar transport 52
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDA
Immunogen EPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf9, CGI-53, dJ1028D15.1, NGD2, NGD5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y366
HTS Code 3002150000
Gene ID 51098
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFT52 Antibody 25ul

Anti-IFT52 Antibody 25ul