C20orf194
  • C20orf194

Anti-C20orf194 Antibody 25ul

Ref: AN-HPA067418-25ul
Anti-C20orf194

Información del producto

Polyclonal Antibody against Human C20orf194, Gene description: chromosome 20 open reading frame 194, Alternative Gene Names: DKFZp434N061, Validated applications: ICC, IHC, Uniprot ID: Q5TEA3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C20orf194
Gene Description chromosome 20 open reading frame 194
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE
Immunogen ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434N061
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TEA3
HTS Code 3002150000
Gene ID 25943
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C20orf194 Antibody 25ul

Anti-C20orf194 Antibody 25ul