COQ7,CAT5,CLK-1
  • COQ7,CAT5,CLK-1

Anti-COQ7 Antibody 100ul

Ref: AN-HPA067252-100ul
Anti-COQ7

Información del producto

Polyclonal Antibody against Human COQ7, Gene description: coenzyme Q7 homolog, ubiquinone (yeast), Alternative Gene Names: CAT5, CLK-1, Validated applications: IHC, Uniprot ID: Q99807, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COQ7
Gene Description coenzyme Q7 homolog, ubiquinone (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFA
Immunogen AYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAT5, CLK-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99807
HTS Code 3002150000
Gene ID 10229
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-COQ7 Antibody 100ul

Anti-COQ7 Antibody 100ul