EFNB1,CFNS,Elk-L
  • EFNB1,CFNS,Elk-L

Anti-EFNB1 Antibody 100ul

Ref: AN-HPA067188-100ul
Anti-EFNB1

Información del producto

Polyclonal Antibody against Human EFNB1, Gene description: ephrin-B1, Alternative Gene Names: CFNS, Elk-L, EPLG2, LERK2, Validated applications: ICC, Uniprot ID: P98172, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EFNB1
Gene Description ephrin-B1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGA
Immunogen VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CFNS, Elk-L, EPLG2, LERK2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P98172
HTS Code 3002150000
Gene ID 1947
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EFNB1 Antibody 100ul

Anti-EFNB1 Antibody 100ul