HES1,bHLHb39
  • HES1,bHLHb39

Anti-HES1 Antibody 100ul

Ref: AN-HPA066929-100ul
Anti-HES1

Información del producto

Polyclonal Antibody against Human HES1, Gene description: hes family bHLH transcription factor 1, Alternative Gene Names: bHLHb39, FLJ20408, HES-1, Hes1, HRY, Validated applications: ICC, WB, Uniprot ID: Q14469, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HES1
Gene Description hes family bHLH transcription factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Immunogen PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb39, FLJ20408, HES-1, Hes1, HRY
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14469
HTS Code 3002150000
Gene ID 3280
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HES1 Antibody 100ul

Anti-HES1 Antibody 100ul