NUP210,FLJ22389
  • NUP210,FLJ22389

Anti-NUP210 Antibody 25ul

Ref: AN-HPA066888-25ul
Anti-NUP210

Información del producto

Polyclonal Antibody against Human NUP210, Gene description: nucleoporin 210kDa, Alternative Gene Names: FLJ22389, GP210, KIAA0906, POM210, Validated applications: IHC, Uniprot ID: Q8TEM1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NUP210
Gene Description nucleoporin 210kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTSLEGLSGTWSSSANSILHIDPKTGVAV
Immunogen TFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTSLEGLSGTWSSSANSILHIDPKTGVAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22389, GP210, KIAA0906, POM210
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TEM1
HTS Code 3002150000
Gene ID 23225
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NUP210 Antibody 25ul

Anti-NUP210 Antibody 25ul