AP4M1,MU-4,MU-ARP2
  • AP4M1,MU-4,MU-ARP2

Anti-AP4M1 Antibody 100ul

Ref: AN-HPA066774-100ul
Anti-AP4M1

Información del producto

Polyclonal Antibody against Human AP4M1, Gene description: adaptor-related protein complex 4, mu 1 subunit, Alternative Gene Names: MU-4, MU-ARP2, SPG50, Validated applications: IHC, Uniprot ID: O00189, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AP4M1
Gene Description adaptor-related protein complex 4, mu 1 subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Immunogen SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MU-4, MU-ARP2, SPG50
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00189
HTS Code 3002150000
Gene ID 9179
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AP4M1 Antibody 100ul

Anti-AP4M1 Antibody 100ul