EHD1,FLJ42622
  • EHD1,FLJ42622

Anti-EHD1 Antibody 100ul

Ref: AN-HPA066751-100ul
Anti-EHD1

Información del producto

Polyclonal Antibody against Human EHD1, Gene description: EH-domain containing 1, Alternative Gene Names: FLJ42622, FLJ44618, H-PAST, HPAST1, PAST1, Validated applications: ICC, Uniprot ID: Q9H4M9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EHD1
Gene Description EH-domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH
Immunogen FVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ42622, FLJ44618, H-PAST, HPAST1, PAST1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4M9
HTS Code 3002150000
Gene ID 10938
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EHD1 Antibody 100ul

Anti-EHD1 Antibody 100ul