SEMA5B,FLJ10372
  • SEMA5B,FLJ10372

Anti-SEMA5B Antibody 100ul

Ref: AN-HPA066548-100ul
Anti-SEMA5B

Información del producto

Polyclonal Antibody against Human SEMA5B, Gene description: sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B, Alternative Gene Names: FLJ10372, KIAA1445, SEMAG, SemG, Validated applications: ICC, IHC, Uniprot ID: Q9P283, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEMA5B
Gene Description sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QESTLVHPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRCFPN
Immunogen QESTLVHPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRCFPN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10372, KIAA1445, SEMAG, SemG
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P283
HTS Code 3002150000
Gene ID 54437
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SEMA5B Antibody 100ul

Anti-SEMA5B Antibody 100ul