CDK5RAP1,C20orf34
  • CDK5RAP1,C20orf34

Anti-CDK5RAP1 Antibody 100ul

Ref: AN-HPA066301-100ul
Anti-CDK5RAP1

Información del producto

Polyclonal Antibody against Human CDK5RAP1, Gene description: CDK5 regulatory subunit associated protein 1, Alternative Gene Names: C20orf34, C42, CGI-05, HSPC167, Validated applications: ICC, WB, Uniprot ID: Q96SZ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDK5RAP1
Gene Description CDK5 regulatory subunit associated protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS
Immunogen RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf34, C42, CGI-05, HSPC167
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96SZ6
HTS Code 3002150000
Gene ID 51654
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDK5RAP1 Antibody 100ul

Anti-CDK5RAP1 Antibody 100ul