PDGFD,IEGF,MSTP036
  • PDGFD,IEGF,MSTP036

Anti-PDGFD Antibody 25ul

Ref: AN-HPA066271-25ul
Anti-PDGFD

Información del producto

Polyclonal Antibody against Human PDGFD, Gene description: platelet derived growth factor D, Alternative Gene Names: IEGF, MSTP036, SCDGF-B, Validated applications: IHC, Uniprot ID: Q9GZP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PDGFD
Gene Description platelet derived growth factor D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP
Immunogen YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IEGF, MSTP036, SCDGF-B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZP0
HTS Code 3002150000
Gene ID 80310
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PDGFD Antibody 25ul

Anti-PDGFD Antibody 25ul