IMP4,BXDC4,MGC19606
  • IMP4,BXDC4,MGC19606

Anti-IMP4 Antibody 25ul

Ref: AN-HPA066222-25ul
Anti-IMP4

Información del producto

Polyclonal Antibody against Human IMP4, Gene description: IMP4, U3 small nucleolar ribonucleoprotein, Alternative Gene Names: BXDC4, MGC19606, Validated applications: ICC, Uniprot ID: Q96G21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IMP4
Gene Description IMP4, U3 small nucleolar ribonucleoprotein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR
Immunogen AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BXDC4, MGC19606
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96G21
HTS Code 3002150000
Gene ID 92856
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IMP4 Antibody 25ul

Anti-IMP4 Antibody 25ul