SH3D21,C1orf113
  • SH3D21,C1orf113

Anti-SH3D21 Antibody 100ul

Ref: AN-HPA066168-100ul
Anti-SH3D21

Información del producto

Polyclonal Antibody against Human SH3D21, Gene description: SH3 domain containing 21, Alternative Gene Names: C1orf113, FLJ22938, Validated applications: ICC, Uniprot ID: A4FU49, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SH3D21
Gene Description SH3 domain containing 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPAS
Immunogen IQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf113, FLJ22938
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A4FU49
HTS Code 3002150000
Gene ID 79729
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SH3D21 Antibody 100ul

Anti-SH3D21 Antibody 100ul