PP2D1,C3orf48
  • PP2D1,C3orf48

Anti-PP2D1 Antibody 100ul

Ref: AN-HPA066083-100ul
Anti-PP2D1

Información del producto

Polyclonal Antibody against Human PP2D1, Gene description: protein phosphatase 2C-like domain containing 1, Alternative Gene Names: C3orf48, FLJ25449, Validated applications: IHC, Uniprot ID: A8MPX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PP2D1
Gene Description protein phosphatase 2C-like domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC
Immunogen PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf48, FLJ25449
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A8MPX8
HTS Code 3002150000
Gene ID 151649
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PP2D1 Antibody 100ul

Anti-PP2D1 Antibody 100ul